PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00796.1.g00250.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 350aa    MW: 37525.7 Da    PI: 9.7275
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00796.1.g00250.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.26.6e-161150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i n+s r  tf kRr+ ++KK +EL +LCd++++v++++ 
  Zpz_sc00796.1.g00250.1.am.mk 11 IANDSARRATFNKRRASLMKKTSELATLCDVDACVLVYGA 50
                                  89************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-22186IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.325161IPR002100Transcription factor, MADS-box
CDDcd002669.55E-29286No hitNo description
PRINTSPR004042.7E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-161149IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MARKKVKLQL IANDSARRAT FNKRRASLMK KTSELATLCD VDACVLVYGA GSSQPEVWPP  60
SATEAARILS RFKAMPEVDQ CKRMMDMEDF LRQRNAKLKE QLEKASKENH KRETALLLHN  120
AITGRGPSVA ALSRDELISL ESTVNTRLKE VMNAIQRLKE QCHGDPATAL QLSMASQSQV  180
PPAVPYTAGS DFSEAVPAPD LESWLLDLTK DEGFGGDSGS FGGGVAGAST SGGLGDMLQL  240
GNTMARLPEA DQKPSFAFPP PMSHFCSEKP TKHGSRPRPQ DREGAKPRRP LGTVIVHVQL  300
EPTVSSHLTG PRQGASIKGD KPPPPPPTVP RPAPDPAATA SSTGSGSLPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008647071.12e-76PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A060D0N92e-76A0A060D0N9_MAIZE; MADS transcription factor (Fragment)
STRINGGRMZM5G839969_P016e-76(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.14e-29AGAMOUS-like 38